DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG18557

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:314 Identity:122/314 - (38%)
Similarity:171/314 - (54%) Gaps:40/314 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCSATGQNEGGAPGIFNGMSFTENLQPDPNQ------------------VCGMSNPNGLVANVKV 62
            ||..:..|:       |.:|:     |.|.|                  .||.||||||...|:.
  Fly    33 LCKTSAWNQ-------NAISW-----PSPCQRSESCCHSSQKLVIGAPLNCGKSNPNGLGGTVEE 85

  Fly    63 PKDYSTPGQFPWVVALFSQ-GKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWN----TGQ 122
            ..|.:.|.:|||.|||... ..:||||:|:...:|:|||.:::.||..:..:..|.|:    .|:
  Fly    86 VVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGK 150

  Fly   123 RSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVT 187
            ..::     |...|:|.|.:|:.:.|||||||:.|...|.:|..|..||.|:.|.|||::||||.
  Fly   151 TIQW-----RTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVA 210

  Fly   188 GWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGG 252
            |||:..|..:|||..||||:||:::|:.|:..||.|....||.|..:::|||||:....|:||||
  Fly   211 GWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGG 275

  Fly   253 SALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQNSN 306
            |.|.||:...|:.||..||||.|..|..|||||:|||:...|.||.:.:....|
  Fly   276 SPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDELN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 103/237 (43%)
Tryp_SPc 67..297 CDD:214473 101/234 (43%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 104/239 (44%)
Tryp_SPc 90..320 CDD:214473 101/234 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471498
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27566
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.