DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG1304

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:117/282 - (41%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTD------- 108
            |.|..|...|...:| :...|||..|:|.:.|.:...||:::...|||||..|..:..       
  Fly    23 SAPGSLNGRVVGGED-AVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPI 86

  Fly   109 -AE-IVVRAGEWNTGQRSEFLPSEDR-------PVARVVQHREFSYLLGANNIALLFLANPFELK 164
             || ..:|||            |.||       .||.|:.|.|:...|  |::|||.|.:|..|.
  Fly    87 AAERFTIRAG------------SNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILS 137

  Fly   165 SHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIE---LPMINRAQCQDQLRNTRLG 226
            :.|:.|.||:.....|.. .:::|||::    ::..::.:.::   |..|:..:|.:.:   ..|
  Fly   138 ASIQPIDLPTADTPADVD-VIISGWGRI----KHQGDLPRYLQYNTLKSISLERCDELI---GWG 194

  Fly   227 VSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQ-----AGIVNWGIGCQEENVPAV 286
            |..:|     |...|.|.|.|.||.|.         |:.|..     ||.| |. .| ..:.|..
  Fly   195 VQSEL-----CLIHEADNGACNGDSGG---------PAVYNNQVVGVAGFV-WS-AC-GTSYPDG 242

  Fly   287 YTNVEMFRDWIYEHMAQNSNSV 308
            |..|....:||     :|::.|
  Fly   243 YARVYYHNEWI-----KNNSDV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 69/256 (27%)
Tryp_SPc 67..297 CDD:214473 67/253 (26%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 69/261 (26%)
Tryp_SPc 32..256 CDD:238113 71/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.