DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Ser6

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:314 Identity:81/314 - (25%)
Similarity:122/314 - (38%) Gaps:90/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWV 75
            ||.|||.......: .|||..||            :|.|..:              :...|||..
  Fly     9 LLCSFLLFLVLPVQ-SAPGKLNG------------RVVGGED--------------AVKNQFPHQ 46

  Fly    76 VALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIV---------VRAGEWNTGQRSEFLPSED 131
            |:|.:.|.:...||::....:||||..|..:....::         :|||            |.|
  Fly    47 VSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAG------------SND 99

  Fly   132 R-------PVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGW 189
            |       .||.|:.|.|:...|  |::|||.|.:|..|.:.|:.|.||:.....|.. .:::||
  Fly   100 RFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQPIDLPTVDTPADVD-VVISGW 161

  Fly   190 GKVAFNDENYSNIQKKIE---LPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDG 251
            |::    ::..::.:.::   |..|.|.||::.       :.|.....| |...:.|.|.|.||.
  Fly   162 GRI----KHQGDLPRYLQYNTLKSITRQQCEEL-------IDFGFEGEL-CLLHQVDNGACNGDS 214

  Fly   252 GSALFCPMEADPSRYEQ-----AGIVNWGIGCQEENVPAVYTNVEMFRDWIYEH 300
            |.         |:.|..     ||.|..|.|   ...|..|..|..|:|||.:|
  Fly   215 GG---------PAVYNNQLVGVAGFVVDGCG---STYPDGYARVFYFKDWIKKH 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 68/256 (27%)
Tryp_SPc 67..297 CDD:214473 66/253 (26%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 68/274 (25%)
Tryp_SPc 32..256 CDD:238113 70/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.