DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG31827

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:319 Identity:143/319 - (44%)
Similarity:185/319 - (57%) Gaps:25/319 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKNWTINTFLLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKD 65
            |.:.||    |:|:.......:|             .||||......||..||:.:.....|.:.
  Fly     1 MFEAWT----LIVALFVLGVAEN-------------VENLQQIEELKCGYGNPDAVKVQFNVTEG 48

  Fly    66 YSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSE 130
            .:.|.:|||.:|:.......|.||||.|::|||||..:..|...:|||.||||..|...|..|.|
  Fly    49 QAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFE 113

  Fly   131 DRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFN 195
            :..|.::|.|:.|:|..||||:|||||...|.|...|.|||||:|.||....||:|.||||..|:
  Fly   114 EAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFS 178

  Fly   196 DENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPME 260
            |.:|..:.|||:||::.|..||||||.||||.::.||..|||||||||...|.||||.||||||.
  Fly   179 DTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMT 243

  Fly   261 ADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQNSNSVPFAAGQLPSNY 319
            .||.::||.||||||:||:|:||||.||:|..|:.||.:.:.:|..:        |.||
  Fly   244 EDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIKENLYT--------PDNY 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 124/232 (53%)
Tryp_SPc 67..297 CDD:214473 122/229 (53%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 124/232 (53%)
Tryp_SPc 50..280 CDD:214473 122/229 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.