DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG33127

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:251 Identity:71/251 - (28%)
Similarity:107/251 - (42%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YSTPG--QFPWVVAL-FSQGKY---FGAGSLIAPEVVLTAASIV----------VGKTDAEIVVR 114
            |...|  ..|::|:| .::..|   .|| |:|....:||||..|          ||..     |.
  Fly    45 YDVQGVDNVPYLVSLSLTRATYTHLCGA-SIIGKRWLLTAAHCVDELRTFNGDAVGTP-----VY 103

  Fly   115 AGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSF 179
            ||..|   ||....::.|.|.....||.|:...|::|||||.::..||..:.::.|.||.....:
  Fly   104 AGIIN---RSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDY 165

  Fly   180 DQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDA 244
            ..|.....|||....:.:.||...:....|::|...|::     .|.....|.|..:|:    ..
  Fly   166 SNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKE-----LLPADAPLTAQQVCS----QV 221

  Fly   245 GDCLGDGGSALFCPMEADPSRYEQAGIVNWG-IGCQEENVPAVYTNVEMFRDWIYE 299
            ..|.||||:.|.......|:  |..|:.:|. :.|...|.|.|||:|..:..||::
  Fly   222 KTCYGDGGTPLIYWPITGPA--ELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 70/250 (28%)
Tryp_SPc 67..297 CDD:214473 68/246 (28%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 71/251 (28%)
Tryp_SPc 41..273 CDD:214473 69/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.