DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG32376

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:269 Identity:77/269 - (28%)
Similarity:121/269 - (44%) Gaps:29/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ENLQPDPNQVCGMSNP--NGLVANVKVPKDYSTPGQFPWVVALFSQGK-----YFGAGSLIAPEV 95
            |::.|.||.....|||  |.|.|....|.......:.|...|.| ||.     ||..|.:|..::
  Fly    36 EDIAPTPNFGNISSNPFINALEAQESFPTRIVNGKRIPCTEAPF-QGSLHYEGYFVCGCVIINKI 99

  Fly    96 -VLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLAN 159
             :|||.....|..: :..||.|.....:..:.     |.|.::|....::.....:::|::.|.:
  Fly   100 WILTAHHCFFGPPE-KYTVRVGSDQQRRGGQL-----RHVKKIVALAAYNDYTMRHDLAMMKLKS 158

  Fly   160 PFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTR 224
            |......:|.:.|||...:...|:.:|:|||..:.|.:|.....:::::..|.|::||...:...
  Fly   159 PVYFGKCVRPVKLPSTKTTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAG 223

  Fly   225 LGVSFDLPASLICAG-GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYT 288
            |.:..|    :|||. ..||:  |.||.|..|       .||....|||:|||||..:|.|.||.
  Fly   224 LKIYKD----MICASRTNKDS--CSGDSGGPL-------TSRGVLYGIVSWGIGCANKNYPGVYV 275

  Fly   289 NVEMFRDWI 297
            |.:.:..||
  Fly   276 NCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 66/238 (28%)
Tryp_SPc 67..297 CDD:214473 64/236 (27%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 64/238 (27%)
Tryp_SPc 66..287 CDD:238113 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.