DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Prss30

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:285 Identity:82/285 - (28%)
Similarity:130/285 - (45%) Gaps:31/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALF-SQGKYFGAGSLIAPE 94
            :||.:..:.|.    .|||.|...|.:    |....:..||:||.|:|: ::..:...||||...
Mouse    52 YNGWARGDILP----SVCGHSRDAGKI----VGGQDALEGQWPWQVSLWITEDGHICGGSLIHEV 108

  Fly    95 VVLTAASIVVGKTDAEIV-VRAGEWNTGQRSEFLPSEDRPVA--RVVQHREFSYL-LGANNIALL 155
            .|||||.......:.... |:.|    |.....|......||  .:..|..:.:. ..:.:|||:
Mouse   109 WVLTAAHCFRRSLNPSFYHVKVG----GLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALV 169

  Fly   156 FLANPFELKSHIRTICLP-SQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQ 219
            .|..|.. .|....:||| :|........|.|||||  |..:.:.:::.:::.:|:::...|:..
Mouse   170 QLDTPLR-PSQFTPVCLPAAQTPLTPGTVCWVTGWG--ATQERDMASVLQELAVPLLDSEDCEKM 231

  Fly   220 LRNTRLGVSFD--LPASLICAG---GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQ 279
            .......:|.:  :.:.::|||   |:||:  |.||.|..|.|.:.   |.:.|.||.:|||||.
Mouse   232 YHTQGSSLSGERIIQSDMLCAGYVEGQKDS--CQGDSGGPLVCSIN---SSWTQVGITSWGIGCA 291

  Fly   280 EENVPAVYTNVEMFRDWIYEHMAQN 304
            ....|.|||.|..:.|||...:|:|
Mouse   292 RPYRPGVYTRVPTYVDWIQRILAEN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 71/243 (29%)
Tryp_SPc 67..297 CDD:214473 69/240 (29%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.