DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Prss42

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:310 Identity:88/310 - (28%)
Similarity:131/310 - (42%) Gaps:60/310 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 APGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDYST----------------------- 68
            |..|.:...|...|...|.:   .|.|...|...||....||                       
  Rat    27 AASILSTSGFPSGLSESPGE---NSPPPTPVHTSKVASQGSTTRFPFTNFSIVCGQPLMKIMGGV 88

  Fly    69 ---PGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSE 130
               .|::||.|:|..:..:...|||:..:.|||||..:..:....:       ..|.||.:..:.
  Rat    89 DAEEGKWPWQVSLRVRHMHVCGGSLLNSQWVLTAAHCIHSRVQYNV-------KMGDRSVYRQNT 146

  Fly   131 DR--PVARVVQHREFS-YLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQK---RCLVTGW 189
            ..  |:..:..|.:|| ..:..|:||||.|..|....|.|..||:|:  .:|..|   :|.||||
  Rat   147 SLVIPIQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICVPT--GTFHVKAGTKCWVTGW 209

  Fly   190 GKVAFNDENY----SNIQKKIELPMINRAQCQDQLRNTRLGVSFDL-PASLICA--GGEKDAGDC 247
            ||   .|...    :.|.::::..:|...:|.:.|:. ....|.|| ...::||  .|.|||  |
  Rat   210 GK---PDPGAPQIPTEILQEVDQSIILYEECNEMLKK-MASTSVDLVKRGMVCAYKEGGKDA--C 268

  Fly   248 LGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWI 297
            .||.|..|.|..:   :|:.|.|:|:|||||..:..|.|||:|..:..|:
  Rat   269 QGDSGGPLSCEFD---NRWVQIGVVSWGIGCGRKGHPGVYTDVAFYNKWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 78/270 (29%)
Tryp_SPc 67..297 CDD:214473 77/268 (29%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 75/248 (30%)
Tryp_SPc 84..315 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.