DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Tpsb2

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:272 Identity:86/272 - (31%)
Similarity:136/272 - (50%) Gaps:33/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CGMSNPNGLVANVKVPKDYSTPGQFPWVVAL---FSQGKYFGAGSLIAPEVVLTAASIVVGKTDA 109
            |.:....|:|...:     ::..::||.|:|   ||...:|..||||.|:.|||||..|      
  Rat    22 CPVKQRVGIVGGRE-----ASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV------ 75

  Fly   110 EIVVRAGE-WNTGQRSEFLPSEDR--PVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTIC 171
            .:.:::.| :....|.::|...|:  .|.|.|.|..:..:....:||||.|.||..:.:||....
  Rat    76 GLHIKSPELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELENPVNVSTHIHPTS 140

  Fly   172 LPSQGRSFDQ-KRCLVTGWGKVAFNDE----NYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDL 231
            ||....:|.. ..|.|||||.:. :||    .|.  .|::::|::..:.| |:..:|.|....|:
  Rat   141 LPPASETFPSGTSCWVTGWGDID-SDEPLLPPYP--LKQVKVPIVENSLC-DRKYHTGLYTGDDV 201

  Fly   232 PA---SLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMF 293
            |.   .::|||..: :..|.||.|..|.|.::   ..:.|||:|:||.||.|.|.|.:||.|..:
  Rat   202 PIVQDGMLCAGNTR-SDSCQGDSGGPLVCKVK---GTWLQAGVVSWGEGCAEANRPGIYTRVTYY 262

  Fly   294 RDWIYEHMAQNS 305
            .|||:.::.|.|
  Rat   263 LDWIHRYVPQRS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 81/246 (33%)
Tryp_SPc 67..297 CDD:214473 79/243 (33%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 82/256 (32%)
Tryp_SPc 30..266 CDD:214473 80/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.