DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Prss34

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:315 Identity:82/315 - (26%)
Similarity:135/315 - (42%) Gaps:66/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPW 74
            ||.::..|                :..|..|.||..|     ...|:|....|     :..:|||
  Rat     8 FLFLTLPC----------------LGSTMPLTPDSGQ-----ELVGIVGGCPV-----SASRFPW 46

  Fly    75 VVAL------FSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRP 133
            .|:|      .|:.::...||||.|:.|||||..|..|   |:.........||...:...:...
  Rat    47 QVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELK---EMEASCFRVQVGQLRLYENDQLMK 108

  Fly   134 VARVVQHREFSYLL---GANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRC-LVTGWGKVAF 194
            ||::::|.:||..|   |..:||||.|.:...|...:..:.||:..:....|:. .|.|||.:  
  Rat   109 VAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWGVI-- 171

  Fly   195 NDENYSNIQ-----KKIELPMINRAQCQDQL-------RNTRLGVSFDLPASLICAGGE-KDAGD 246
              |.:..:.     :::.:|::..:.|:.:.       |.|::     :...::|||.| :|:  
  Rat   172 --EGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKI-----IKDDMLCAGMEGRDS-- 227

  Fly   247 CLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHM 301
            |..|.|..|.|.....   :.|.|:|:|||||...:.|.|||.|..:..||:.::
  Rat   228 CQADSGGPLVCRWNCS---WVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWIHGYV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 71/255 (28%)
Tryp_SPc 67..297 CDD:214473 69/252 (27%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 72/264 (27%)
Tryp_SPc 33..275 CDD:214473 71/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.