DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG33226

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:291 Identity:78/291 - (26%)
Similarity:117/291 - (40%) Gaps:77/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DPN----------QVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVL 97
            |||          |:.|..|     |::|:         .||:|.:..:|.:|..||||:...||
  Fly    33 DPNCVQTPVGVREQILGGHN-----ADIKL---------HPWMVQILQRGYHFCGGSLISSLFVL 83

  Fly    98 TAASIVVGKTDAEIVVRAGEW---------NTGQRSEFLPSEDRPVARVVQHREF----SYLLGA 149
            |||..   .:...:.||.|.:         ::...|.|.|..|  |.|:..|..:    :|    
  Fly    84 TAAHC---HSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEID--VKRIFLHSSYRDYHNY---- 139

  Fly   150 NNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCL-------VTGWGKVAFNDENYSNIQKKIE 207
             :|||..||.|.......|.||:.........::.|       ||||||.  ..:..|.|.:...
  Fly   140 -DIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKT--ESQLTSTILQTTS 201

  Fly   208 LPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEAD-----PSRYE 267
            |..::|..|. |:.:.::|...      ||| |...:..|.||.|.    |:.|:     ..|..
  Fly   202 LFHLDRKFCA-QIFDRKIGWPH------ICA-GHSQSSTCTGDSGG----PLSAELTFSGVKRTV 254

  Fly   268 QAGIVNWGI-GCQEENVPAVYTNVEMFRDWI 297
            ..||:::|. .|:|   ..|:|||..:.:||
  Fly   255 LFGIISYGAPNCRE---VTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 70/257 (27%)
Tryp_SPc 67..297 CDD:214473 68/255 (27%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 74/277 (27%)
Tryp_SPc 47..282 CDD:214473 72/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.