DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and TPSG1

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:317 Identity:90/317 - (28%)
Similarity:132/317 - (41%) Gaps:54/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDYSTP-GQFPWVV 76
            |.||.|..     |.|..|:               .|...|....|..::...::.| |.:||..
Human    34 VGFLGSPP-----GTPSSFD---------------LGCGRPQVSDAGGRIVGGHAAPAGAWPWQA 78

  Fly    77 ALFSQGKYFGAGSLIAPEVVLTAASIVVGK-TDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQH 140
            :|..:..:...|||::|:.|||||....|. ..::..|..||........|     ..|.:::.|
Human    79 SLRLRRVHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHF-----STVRQIILH 138

  Fly   141 REFSYLLG-ANNIALLFLANPFELKSHIRTICLPSQGRSF-DQKRCLVTGWGKVAFNDEN----- 198
            ...|...| :.:|||:.|:.|..|.|.|..:|||.....| ...||.|||||   :..|.     
Human   139 SSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWG---YTREGEPLPP 200

  Fly   199 -YSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEAD 262
             ||  .:::::.:::...|:......  |.|. |...::||.|..||  |..|.|..|.|.:.  
Human   201 PYS--LREVKVSVVDTETCRRDYPGP--GGSI-LQPDMLCARGPGDA--CQDDSGGPLVCQVN-- 256

  Fly   263 PSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQNSNS------VPFAAG 313
             ..:.|||.|:||.||...|.|.|||.|..:.:||..|:..:..|      :|..||
Human   257 -GAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 75/242 (31%)
Tryp_SPc 67..297 CDD:214473 73/239 (31%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 73/245 (30%)
Tryp_SPc 63..293 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.