DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG30287

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:293 Identity:84/293 - (28%)
Similarity:121/293 - (41%) Gaps:59/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QP---DPNQVCGMSNPNGL--VANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAA 100
            ||   ||..|...|.| ||  |.|.|....:|.    ||:|.:..:|.....||||.|..|||||
  Fly    22 QPHLLDPQCVTARSEP-GLYRVINGKPADLFSN----PWMVIIIERGMMKCGGSLITPRYVLTAA 81

  Fly   101 SIVVGKTDAEIVVRAGEWNTGQRSE-----FLPSEDRP----VARVVQHREFSYLLGANNIALLF 156
            . ...:|.:::.||.|:::..|..:     .:|   ||    |.|......::. ...|:||||.
  Fly    82 H-CKSETKSQLTVRLGDYDVNQAVDCSSYGCIP---RPREINVTRTYVPSHYTN-FRKNDIALLR 141

  Fly   157 LANPFELKSHIRTICLPSQGRSFDQK--RCLV----TGWGKVAFNDENYSNIQKKIELPMINRAQ 215
            |....:...:||:|||.....::...  :.||    ||||:.          :.:|..|::.:|.
  Fly   142 LETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRT----------ESRINSPVLQQAS 196

  Fly   216 CQDQLRNTRLGVSF-------DLPASLICAGGEKDAGDCLGDGGSALFCPME-ADPSRYEQAGIV 272
            .      |...:|:       .|..|.||. .......|.||.|..|...:. ....|....|:|
  Fly   197 L------THHHLSYCAQVFGKQLDKSHICV-ASSTGSTCQGDSGGPLTARVRIGSERRVILFGVV 254

  Fly   273 NWG-IGCQEENVPAVYTNVEMFRDWIYEHMAQN 304
            ::| :.|..   |.|||||..|.:||..|..:|
  Fly   255 SYGAVHCFG---PTVYTNVIHFANWIELHTKKN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 70/256 (27%)
Tryp_SPc 67..297 CDD:214473 68/253 (27%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/264 (27%)
Tryp_SPc 42..280 CDD:238113 73/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.