DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG30088

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:269 Identity:69/269 - (25%)
Similarity:116/269 - (43%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAA-------SIVVG 105
            ||:|..:.:...:...|:...... |::..|:...:....|::|:...:||||       .:.:|
  Fly    33 CGVSYESNVATRIVRGKEAMLKSA-PFMAYLYYSSEIHCGGTIISSRYILTAAHCMRPYLKVRLG 96

  Fly   106 KTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTI 170
            :.|   :.|..:...|..|.  |:|:..:....:::.|...| ||:||||.|:.......||:.|
  Fly    97 EHD---ITRNPDCQGGSCSP--PAEEFDIVLATKYKRFDRFL-ANDIALLKLSRNIRFNVHIQPI 155

  Fly   171 CL---PSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLP 232
            ||   |:...:..:.:..  |||:...|  :.:|:.:...|...:...|:..|       |..:.
  Fly   156 CLILNPAAAPNVHEFQAF--GWGQTETN--HSANVLQTTVLTRYDNRHCRSVL-------SMPIT 209

  Fly   233 ASLICAGGEKDAGDCLGDGGSALFCPMEADPS-RYEQAGIVNWGIG-CQEENVPAVYTNVEMFRD 295
            .:.:|.|.: .:..|.||.|..|...:..|.. ||.|.|||::|.. ||.   |.|||.|..:..
  Fly   210 INQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS---PGVYTYVPNYIR 270

  Fly   296 WIYEHMAQN 304
            ||...|..|
  Fly   271 WIRYVMQSN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 63/244 (26%)
Tryp_SPc 67..297 CDD:214473 61/241 (25%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 62/249 (25%)
Tryp_SPc 45..273 CDD:238113 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.