DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG30083

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:239 Identity:72/239 - (30%)
Similarity:110/239 - (46%) Gaps:37/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GQFPWVVALFSQGKY--------FGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEF 126
            |..||:..:|   ||        ...|:||..:.||:||..:  |.|..:.||.||.::      
  Fly    43 GTNPWMAYIF---KYNDKEVAELVCGGTLIHKQFVLSAAHCI--KRDQILAVRLGEHSS------ 96

  Fly   127 LPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSF-DQKRCLVTGWG 190
              |....|.:..:::.|:....:|:|.:|.:....:..:.||.||:.:..... :.|.....|||
  Fly    97 --SRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWG 159

  Fly   191 KVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSAL 255
            |.  .:|.:|.:.|.:||..:|.::|.:.|       ..::..|.||| |..|...|.||.|..|
  Fly   160 KT--ENETFSKVLKTVELNELNASECYNML-------WVNVTESQICA-GHPDGDTCAGDSGGPL 214

  Fly   256 FCPMEADPS-RYEQAGIVNWGIG-CQEENVPAVYTNVEMFRDWI 297
            ..|:..|.| ||.|.||:::|.. |   |.|.|||.:..|.|||
  Fly   215 IHPVYMDGSLRYVQLGIISFGSSLC---NSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 72/239 (30%)
Tryp_SPc 67..297 CDD:214473 70/237 (30%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 70/237 (30%)
Tryp_SPc 34..255 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.