DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and CG30082

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:276 Identity:82/276 - (29%)
Similarity:118/276 - (42%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAAS 101
            |.|| |..|::.|     |..|::         |..||:..|.........|:||....|||||.
  Fly    31 TINL-PPTNRIVG-----GRTADI---------GSNPWLAYLHKNSSLVCTGTLITKRFVLTAAH 80

  Fly   102 IVVGKTDAEIVVRAGEWNTGQR----SEF-LPS-EDRPVARVVQHREFSYLLGA-NNIALLFLAN 159
            .:  .:...:.||.||::|..|    ||| :|: |:..|.....|..|.....: |:|.||.|..
  Fly    81 CL--HSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNG 143

  Fly   160 PFELKSHIRTICL---PSQ---GRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQD 218
            ....|..||.|||   |.|   ..:::     ..||||:..  .|.:.:.:.:.|..::::.|:.
  Fly   144 TVVYKLFIRPICLFRDPGQVPYSSTYE-----AAGWGKIDL--INTATVLQTVNLIRLDQSDCER 201

  Fly   219 QLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPM-EADPSRYEQAGIVNWG-IGCQEE 281
            .||.:       |.....|| |:..|..|.||.|..|...| ....:|..|.|||::| ..|:. 
  Fly   202 SLRTS-------LSYGQFCA-GQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG- 257

  Fly   282 NVPAVYTNVEMFRDWI 297
              |.|||.|..|.:||
  Fly   258 --PGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 74/246 (30%)
Tryp_SPc 67..297 CDD:214473 72/244 (30%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 75/265 (28%)
Tryp_SPc 40..274 CDD:238113 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.