DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and TPSD1

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:229 Identity:72/229 - (31%)
Similarity:107/229 - (46%) Gaps:31/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKY---FGAGSLIAPEVVLTAASIV 103
            |.|.|..   ...|:|...:.|:     .::||.|:|..:|.|   |..||||.|:.|||||..|
Human    27 PAPGQAL---QQTGIVGGQEAPR-----SKWPWQVSLRVRGPYWMHFCGGSLIHPQWVLTAAHCV 83

  Fly   104 VG--KTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSH 166
            ..  |..|.:.|:..|.:...:.:.|     ||:|::.|.:|..:....:||||.|..|..:.||
Human    84 EPDIKDLAALRVQLREQHLYYQDQLL-----PVSRIIVHPQFYIIQTGADIALLELEEPVNISSH 143

  Fly   167 IRTICLPSQGRSFDQ-KRCLVTGWGKVAFNDENYSNIQ-----KKIELPMINRAQCQDQLR-NTR 224
            |.|:.||....:|.. ..|.|||||.|    :|..::.     |::|:|::....|..:.. ...
Human   144 IHTVTLPPASETFPPGMPCWVTGWGDV----DNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLH 204

  Fly   225 LGVSFDLPA-SLICAGGEKDAGDCLGDGGSALFC 257
            .|.||.:.. .::|||.| :...|.||.|..|.|
Human   205 TGHSFQIVRDDMLCAGSE-NHDSCQGDSGGPLVC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 66/204 (32%)
Tryp_SPc 67..297 CDD:214473 66/204 (32%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 68/215 (32%)
Tryp_SPc 38..240 CDD:214473 68/215 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.