DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and PRSS21

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:287 Identity:85/287 - (29%)
Similarity:141/287 - (49%) Gaps:31/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QPDPNQVCGMSNPNG--LVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIV 103
            :|:..:...:|.|.|  ::.:..|..:.:..|::||..:|.....:....||::....||||...
Human    20 KPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF 84

  Fly   104 VGKTDAEIVVRAGEW--NTGQRSEFLPSEDRPVARVVQHREFS-YL----LGAN--NIALLFLAN 159
              :|.:::...:| |  ..||.:. :||.....|...::...: ||    ||.:  :|||:.|:.
Human    85 --ETYSDLSDPSG-WMVQFGQLTS-MPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSA 145

  Fly   160 PFELKSHIRTICLPSQGRSFDQKR-CLVTGWGKVAFNDENYS-NIQKKIELPMINRAQCQDQLRN 222
            |.....||:.|||.:....|:.:. |.|||||.:..::...| :..:::::.:||.:.|    .:
Human   146 PVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMC----NH 206

  Fly   223 TRLGVSF--DLPASLICAG---GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEEN 282
            ..|..||  |:...::|||   |.|||  |.||.|..|.|...   ..:.|.|:|:||:||...|
Human   207 LFLKYSFRKDIFGDMVCAGNAQGGKDA--CFGDSGGPLACNKN---GLWYQIGVVSWGVGCGRPN 266

  Fly   283 VPAVYTNVEMFRDWIYEHMAQNSNSVP 309
            .|.||||:....:||.:.|||:..|.|
Human   267 RPGVYTNISHHFEWIQKLMAQSGMSQP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 75/248 (30%)
Tryp_SPc 67..297 CDD:214473 73/245 (30%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.