DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Prss48

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:291 Identity:88/291 - (30%)
Similarity:135/291 - (46%) Gaps:56/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAP 93
            |.:.| |.|:  |.....|||....:|.:    |....:..|.:||.|:|.....:...||||:.
  Rat    15 GAYQG-SLTK--QKKLQSVCGRPVYSGRI----VGGQGAALGHWPWQVSLRFDSTHICGGSLISN 72

  Fly    94 EVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRP---------VARVV---QHREFSYL 146
            ..|:|||. .:.||          |.:...|.:|.|.||.         |:|:|   :|....  
  Rat    73 HWVMTAAH-CIKKT----------WFSFLYSVWLGSIDRDYSSTGEEYYVSRIVIPSKHHNTD-- 124

  Fly   147 LGANNIALLFLANPFELKSHIRTICLPSQGRSFD-QKRCLVTGWGKVAFNDE-NYSNIQKKIELP 209
               .:||||.|::.....|.:..||||:..:... ...|.|||||:   |.| :|.:..:::|:|
  Rat   125 ---GDIALLKLSSRVTFTSLVLPICLPNISKPLTVPASCWVTGWGQ---NQEGHYPSTLQELEVP 183

  Fly   210 MINRAQCQDQLRNTRLGVSFDLP-------ASLICAGGEKDAGD-CLGDGGSALFCPMEADPSRY 266
            :|....| :||.|.   :.|.||       ..::|||..:.:.| |.||.|..|.|.::   ..:
  Rat   184 IITGEAC-EQLYNP---IGFFLPDLERIIKEDMLCAGEIQQSKDSCKGDSGGPLSCHID---GVW 241

  Fly   267 EQAGIVNWGIGCQEENVPAVYTNVEMFRDWI 297
            .|.|:::||:.| .:|:|.|||||..::.||
  Rat   242 TQIGVISWGLEC-GKNLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 78/253 (31%)
Tryp_SPc 67..297 CDD:214473 76/251 (30%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.