DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:271 Identity:82/271 - (30%)
Similarity:128/271 - (47%) Gaps:49/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VCG---MSNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTD 108
            |||   :::.||.|..     ..|:...:||..:|:........||||..|.||:||....|:  
Zfish   296 VCGIIPVNSSNGTVGG-----QNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQ-- 353

  Fly   109 AEIVVRAGEWNT---GQRSE--FLPSE-DRPVARVVQHREFSYLLGANNIALLFLANPFELKSHI 167
                 |.|.:.|   |.:::  :.||. .|.|..|::|..::.....|:|||:.|:.|......|
Zfish   354 -----RNGFYLTVILGPKTQNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSI 413

  Fly   168 RTICLPSQGRSFD-QKRCLVTGWGKVAFNDENYSN--------IQKKIELPMINRAQCQDQLRNT 223
            |.:||.::|..|: .....:|.|       .|.|:        |.:::|:|:|...||     |.
Zfish   414 RPVCLAAEGSVFNSDTESWITTW-------RNISDGVPLPSPKIFQEVEVPVIGNRQC-----NC 466

  Fly   224 RLGVSFDLPASLICAGGEKDAGD-CLGDGGSALFCPMEADPSR-YEQAGIVNWGIGCQEENVPAV 286
            ..||. .:..::||||..|:..| |.||.|.    ||.::.|. :.|:|||::|.||.:...|.|
Zfish   467 LYGVG-SITDNMICAGLLKEGKDLCQGDSGG----PMVSNQSSVWVQSGIVSFGSGCAQSEFPGV 526

  Fly   287 YTNVEMFRDWI 297
            ||.|..:::||
Zfish   527 YTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 76/248 (31%)
Tryp_SPc 67..297 CDD:214473 74/246 (30%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 75/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.