DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and Tpsab1

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:255 Identity:76/255 - (29%)
Similarity:118/255 - (46%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QFPWVVALFSQGKY---FGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDR 132
            ::||.|:|.:...|   |..||||.|:.|||||..|     ...|....:.....|.::|...|.
Mouse    39 KWPWQVSLRANDTYWMHFCGGSLIHPQWVLTAAHCV-----GPDVADPNKVRVQLRKQYLYYHDH 98

  Fly   133 --PVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQ-KRCLVTGWGKVAF 194
              .|::::.|.:|..:....:||||.|.||..:..::..:.||....:|.. ..|.|||||    
Mouse    99 LMTVSQIITHPDFYIVQDGADIALLKLTNPVNISDYVHPVPLPPASETFPSGTLCWVTGWG---- 159

  Fly   195 NDENYSNIQ-----KKIELPMINRAQCQ----------DQLRNTRLGVSFDLPASLICAGGEKDA 244
            |.:|..|:.     |::::|:|....|.          |.:...|        ..::|||.| ..
Mouse   160 NIDNGVNLPPPFPLKEVQVPIIENHLCDLKYHKGLITGDNVHIVR--------DDMLCAGNE-GH 215

  Fly   245 GDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQN 304
            ..|.||.|..|.|.:|   ..:.|||:|:||.||.:.|.|.:||.|..:.|||:.::.::
Mouse   216 DSCQGDSGGPLVCKVE---DTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKD 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 76/249 (31%)
Tryp_SPc 67..297 CDD:214473 74/246 (30%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 75/247 (30%)
Tryp_SPc 29..265 CDD:214473 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.