DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14990 and zgc:165423

DIOPT Version :9

Sequence 1:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:307 Identity:80/307 - (26%)
Similarity:144/307 - (46%) Gaps:52/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPN-QVCGMSNPNGLVANVKVPKDYSTPGQFP 73
            |..:|.||..|..:.|.            :.||..: ..||.:..|..:    |....::.|.:|
Zfish     2 FWKLSLLCVVTLLSTGC------------DCQPTQSPPACGKAPLNTKI----VGGTNASAGSWP 50

  Fly    74 WVVALFSQGKYFGAGSLIAPEVVLTAASIVVGK---TDAEIVVRAGEWNTGQRSEFLPSED---R 132
            |..:|...|.:|..||||:.:.:|:||......   :|..:.:       |::|:.||:.:   :
Zfish    51 WQASLHESGSHFCGGSLISDQWILSAAHCFPSNPNPSDYTVYL-------GRQSQDLPNPNEVSK 108

  Fly   133 PVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDE 197
            .|::|:.|..:......|::|||.|::|....::|:.:||.:.|.:|......:||||.:   :.
Zfish   109 SVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVCLAADGSTFYNDTMWITGWGTI---ES 170

  Fly   198 NYS----NIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAG---GEKDAGDCLGDGGSAL 255
            ..|    .|.:::.:|::....|     |...|....:..:::|||   |.||:  |.||.|.  
Zfish   171 GVSLPSPQILQEVNVPIVGNNLC-----NCLYGGGSSITNNMMCAGLMQGGKDS--CQGDSGG-- 226

  Fly   256 FCPMEADP-SRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHM 301
              ||.... :.:.|||:|::|.||.:.|.|.||..|..:::||.:::
Zfish   227 --PMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQYV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 68/246 (28%)
Tryp_SPc 67..297 CDD:214473 66/243 (27%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 67/254 (26%)
Tryp_SPc 38..269 CDD:238113 69/255 (27%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.