DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gad1 and EMB1075

DIOPT Version :9

Sequence 1:NP_001261396.1 Gene:Gad1 / 38484 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_175036.1 Gene:EMB1075 / 840958 AraportID:AT1G43710 Length:482 Species:Arabidopsis thaliana


Alignment Length:261 Identity:68/261 - (26%)
Similarity:111/261 - (42%) Gaps:55/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 GSISNLYAFLAARHKMFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSDE 231
            |:..||:..|..| :|||:.            :::.|.:.|||:...|.:..:   .|..|.:..
plant   174 GTEGNLHGILVGR-EMFPDG------------ILYASRESHYSVFKAARMYRM---ECEKVDTLM 222

  Fly   232 HGKMITSELERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICQKYNC-------WMHID 289
            .|::...:|.:.:|..|   |.|..:|...||||.||.||::.:....::  |       ::|.|
plant   223 SGEIDCDDLRKKLLANK---DKPAILNVNIGTTVKGAVDDLDLVIKTLEE--CGFSHDRFYIHCD 282

  Fly   290 AAWGGGLLMSRKHRHPRFTGVERADSVTWNPHKLMGALLQCST-----IHFKEDGLLISCNQMSA 349
            .|. .||:|....|.|:.|..:...||:.:.||.:|..:.|..     .|.|    ::|.|   .
plant   283 GAL-FGLMMPFVKRAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIK----VLSSN---V 339

  Fly   350 EYLFMTDKQYDISYDTGDKVIQCGR--HNDIFKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIR 412
            |||           .:.|..|...|  |..:| ||.....||.:||:::..:.:....|...|:|
plant   340 EYL-----------ASRDATIMGSRNGHAPLF-LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLR 392

  Fly   413 E 413
            |
plant   393 E 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gad1NP_001261396.1 Pyridoxal_deC 64..434 CDD:395219 68/261 (26%)
EMB1075NP_175036.1 PLN02263 15..482 CDD:177904 68/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D810772at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.