DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gad1 and AT2G28230

DIOPT Version :10

Sequence 1:NP_523914.2 Gene:Gad1 / 38484 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_180390.2 Gene:AT2G28230 / 817369 AraportID:AT2G28230 Length:219 Species:Arabidopsis thaliana


Alignment Length:109 Identity:23/109 - (21%)
Similarity:45/109 - (41%) Gaps:20/109 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 QCSTIHFKEDGLLISCNQMSAEYLFMTDKQYDISYDTGDKVIQCGRHNDIFKLWLQWRAKGT--- 390
            |.:.:.|..|.|.||......:|.|:...|..:.  ..|..||.     |.:....:::|..   
plant    54 QANQLEFPRDFLGISLADQPNKYYFIIRTQRIVL--EADSSIQL-----IMEKLQSYKSKVALYF 111

  Fly   391 EGFEQQ----QDRLMELVQYQLKRIREQSDRFHLILEPECVNVS 430
            :||:.|    :.|:.::|....:.:|      .:::|.|.:.:|
plant   112 DGFQYQLGDFRLRVGKVVPTHSENVR------GIVMEVEYLPIS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gad1NP_523914.2 Pyridoxal_deC 64..434 CDD:395219 23/109 (21%)
AT2G28230NP_180390.2 Med20 1..208 CDD:400779 23/109 (21%)

Return to query results.
Submit another query.