DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gad1 and Sepsecs

DIOPT Version :9

Sequence 1:NP_001261396.1 Gene:Gad1 / 38484 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001121759.1 Gene:Sepsecs / 679383 RGDID:1589491 Length:504 Species:Rattus norvegicus


Alignment Length:353 Identity:69/353 - (19%)
Similarity:110/353 - (31%) Gaps:140/353 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNPNGYKLSERTGKLTAYDLMPTTVTAGPETREFLLKVIDVLLDFVKATNDR-NEKVLD-FHHPE 65
            :||..:...||.       :.|..|..|.|.|.....:|.:|::..|...|. :|..|: |.|  
  Rat     1 MNPESFAAGERR-------VTPAYVRQGCEARRAHEHLIWLLIEQGKCPEDGWDESTLELFLH-- 56

  Fly    66 DMKRLLDLDVPDRALPLQQLIEDC---------ATTL-------------------KYQVKTGHP 102
                  :|.|.|.    ...:.:|         |:.|                   ..|.|....
  Rat    57 ------ELAVMDS----NNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAGS 111

  Fly   103 HFFNQLSNG--LDLISMAGEWLTATANTNMFTYEIAPVFILMENVVLTKMREIIGWSGGDSILAP 165
            ...|:::|.  |::|.:||            .:.:|..|::.                    :|.
  Rat   112 SLLNKITNSLVLNVIKLAG------------VHSVASCFVVP--------------------MAT 144

  Fly   166 GGSISNLYAFLAARHKMFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSD 230
            |.|::  ..||..|||. |..|         .::....||     |||                 
  Rat   145 GMSLT--LCFLTLRHKR-PKAK---------YIIWPRIDQ-----KSC----------------- 175

  Fly   231 EHGKMITSELERLILERKAKGDI----------------PFFVNATAGTTVLGA---FDDINTIA 276
             ...|:|:..|.:::|...:||.                |..:.....||...|   .|.:..:|
  Rat   176 -FKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPEHILCLHSTTACFAPRVPDRLEELA 239

  Fly   277 DICQKYNCWMHIDAAWGGGLLMSRKHRH 304
            .||..|:....::.|:|   |.|.|..|
  Rat   240 VICANYDIPHVVNNAYG---LQSSKCMH 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gad1NP_001261396.1 Pyridoxal_deC 64..434 CDD:395219 52/290 (18%)
SepsecsNP_001121759.1 selenium_SpcS 13..458 CDD:211833 65/334 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.