DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gad1 and SecS

DIOPT Version :10

Sequence 1:NP_523914.2 Gene:Gad1 / 38484 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster


Alignment Length:93 Identity:17/93 - (18%)
Similarity:31/93 - (33%) Gaps:38/93 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NCSFLGNFRKLK---KHMKEK---------HPHACPRAIDPALE--------------------- 149
            ||  ||:.:|:.   :.:.:|         |..:.|....|:|:                     
  Fly    62 NC--LGDIKKILFAIEFLSQKVVEIGNSGVHHRSTPNGNGPSLKNSKDGLLVEYNEQNHLSISGE 124

  Fly   150 ---TKWKRLERERDRRDVISTIMSSTPG 174
               |..:|.|...|...::.|:..|:.|
  Fly   125 DVYTTTRRAEIVEDEETLLDTLAKSSDG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gad1NP_523914.2 Pyridoxal_deC 64..434 CDD:395219 17/93 (18%)
SecSNP_649556.3 AAT_I 12..457 CDD:450240 17/93 (18%)

Return to query results.
Submit another query.