DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gad1 and Sgpl1

DIOPT Version :9

Sequence 1:NP_001261396.1 Gene:Gad1 / 38484 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_008771093.2 Gene:Sgpl1 / 286896 RGDID:628599 Length:648 Species:Rattus norvegicus


Alignment Length:303 Identity:60/303 - (19%)
Similarity:100/303 - (33%) Gaps:103/303 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 MFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCGLGTDH----C----------------IV 226
            :||..::     |...:|..|....:....||..|...||:.    |                ||
  Rat   257 IFPGLRK-----LEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIV 316

  Fly   227 VPSDEHGKM------ITSELERLILERKAKGDIPFFVNATAGTTVL----------GAFDDINTI 275
            .|...|...      ...::.|:..::..:.|:.....|.:..|.:          |..|.|..:
  Rat   317 APESAHAAFDKAAHYFGMKIVRVAQKKNMEVDVRAMKRAISRNTAMLVCSAPQFPHGVIDPIPEV 381

  Fly   276 ADICQKYNCWMHIDAAWGGGLLM-SRKHRHP-------RFTGVERADSVTWNPHK---------- 322
            |.:..||....|:||..||.|:: ..|..:|       |..||   .|::.:.||          
  Rat   382 AKLAVKYKIPFHVDACLGGFLIVFMEKAGYPLEKPFDFRVKGV---TSISADTHKYGYAPKGSSV 443

  Fly   323 LM---------------------------------GALLQC--STIHFKEDGLLISCNQMSAEYL 352
            :|                                 |.:..|  :.:||.|:|.:.:..|:.....
  Rat   444 VMYSNEKYRKYQFFVDADWQGGIYASPSIAGSRPGGIIAACWAALMHFGENGYVEATKQIIKTAR 508

  Fly   353 FMTDKQYDIS--YDTGD---KVIQCGRHN-DIFKLWLQWRAKG 389
            |:..:..:|.  :..||   .||..|.:: ||::|.....|||
  Rat   509 FLKSELENIKNIFILGDPQLSVIALGSNDFDIYRLSNMMSAKG 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gad1NP_001261396.1 Pyridoxal_deC 64..434 CDD:395219 60/303 (20%)
Sgpl1XP_008771093.2 DOPA_deC_like 226..587 CDD:99743 60/303 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.