DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gad1 and Sgpl1

DIOPT Version :9

Sequence 1:NP_001261396.1 Gene:Gad1 / 38484 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001303602.1 Gene:Sgpl1 / 20397 MGIID:1261415 Length:568 Species:Mus musculus


Alignment Length:406 Identity:76/406 - (18%)
Similarity:135/406 - (33%) Gaps:133/406 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LPLQQLIEDCATTLKYQVKTGHPHFFNQLSNGLDLISMAGEWLTATANTNMFTYEIAPVFILMEN 144
            :|..::.:|...||..| ..|......:|.   :..||.|.|....|:..::..|          
Mouse   103 MPFLKVDKDYVKTLPAQ-GMGTAEVLERLK---EYSSMDGSWQEGKASGAVYNGE---------- 153

  Fly   145 VVLTKMREIIGWSGGDSILAPGGSISNLYAFLAARH-KMFPNYKEHGSVGLPGTLVMFTSDQCHY 208
               .|:.|::..:.|:            :.:....| .:||..::     |...:|..|....:.
Mouse   154 ---PKLTELLVQAYGE------------FTWSNPLHPDIFPGLRK-----LEAEIVRMTCSLFNG 198

  Fly   209 SIKSCAAVCGLGTDH----C----------------IVVPSDEHGKM------ITSELERLILER 247
            ...||..|...||:.    |                ||.|...|...      ...::.|:.|::
Mouse   199 GPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIVAPESAHAAFDKAAHYFGMKIVRVALKK 263

  Fly   248 KAKGDIPFFVNATAGTTVL----------GAFDDINTIADICQKYNCWMHIDAAWGGGLLM-SRK 301
            ..:.|:.....|.:..|.:          |..|.:..:|.:..:|...:|:||..||.|:: ..|
Mouse   264 NMEVDVQAMKRAISRNTAMLVCSTPQFPHGVMDPVPEVAKLAVRYKIPLHVDACLGGFLIVFMEK 328

  Fly   302 HRHP-------RFTGVERADSVTWNPHK----------LM------------------------- 324
            ..:|       |..||   .|::.:.||          :|                         
Mouse   329 AGYPLEKPFDFRVKGV---TSISADTHKYGYAPKGSSVVMYSNEKYRTYQFFVGADWQGGVYASP 390

  Fly   325 --------GALLQC--STIHFKEDGLLISCNQMSAEYLFMTDKQYDIS--YDTGD---KVIQCGR 374
                    |.:..|  :.:||.|:|.:.:..|:.....|:..:..:|.  :..||   .||..|.
Mouse   391 SIAGSRPGGIIAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKNIFIFGDPQLSVIALGS 455

  Fly   375 HN-DIFKLWLQWRAKG 389
            :: ||::|.....|||
Mouse   456 NDFDIYRLSNMMSAKG 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gad1NP_001261396.1 Pyridoxal_deC 64..434 CDD:395219 76/406 (19%)
Sgpl1NP_001303602.1 DOPA_deC_like 146..507 CDD:99743 64/359 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.