DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gad1 and spl-2

DIOPT Version :9

Sequence 1:NP_001261396.1 Gene:Gad1 / 38484 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_505372.1 Gene:spl-2 / 181859 WormBaseID:WBGene00006418 Length:542 Species:Caenorhabditis elegans


Alignment Length:419 Identity:97/419 - (23%)
Similarity:162/419 - (38%) Gaps:94/419 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TTVTAGPETREFLLKVIDVLLDFVKATNDRNEKVLDFHHPEDMKRLLD------LDVPDRALPLQ 83
            |||...|    |:.|:||..|:.||   |..||.|         |::|      ..:|..::...
 Worm    61 TTVKRVP----FIRKMIDKQLNEVK---DELEKSL---------RIVDRSTEYFTTIPSHSVGRT 109

  Fly    84 QLIEDCATTLKYQVKTGHPHF---------FNQLSNGLDLISMAGEWLTATANTNMFTYEIAPVF 139
            :::...|.   |....| |.|         ||: .:..|...|..|.....|.||....::.|..
 Worm   110 EVLRLAAI---YDDLEG-PAFLEGRVSGAVFNR-EDDKDEREMYEEVFGKFAWTNPLWPKLFPGV 169

  Fly   140 ILMENVVLTKMREIIGWSGGDS----ILAPGGSISNLYAFLAARHKMFPNYKEHGSVGLPGTL-- 198
            .:||..|   :|.......|||    .::.|||||.|.|.||.|:::....:::..:.:|.::  
 Worm   170 RIMEAEV---VRMCCNMMNGDSETCGTMSTGGSISILLACLAHRNRLLKRGEKYTEMIVPSSVHA 231

  Fly   199 VMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSDEHGKMITSELERLILERKAK---------GDIP 254
            ..|.:.:| :.||            ...:|.|.    :|.:::  :::.||.         |..|
 Worm   232 AFFKAAEC-FRIK------------VRKIPVDP----VTFKVD--LVKMKAAINKRTCMLVGSAP 277

  Fly   255 FFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLLMSRKHRHPRFT-GVERADSVTW 318
            .|        ..|..|||..|..:..:|:..:|:||..||.||...:....|:. .|....|::.
 Worm   278 NF--------PFGTVDDIEAIGQLGLEYDIPVHVDACLGGFLLPFLEEDEIRYDFRVPGVSSISA 334

  Fly   319 NPHKLMGALLQCSTIHFKEDGLLISCNQMSAEYLFMTDKQYDISYDTGDKVIQCGRHNDIFKLWL 383
            :.||...|....|.:.::...||.:      :|....|.|..|......:..:.| || |...|.
 Worm   335 DSHKYGLAPKGSSVVLYRNKELLHN------QYFCDADWQGGIYASATMEGSRAG-HN-IALCWA 391

  Fly   384 QWRAKGTEGFEQQQDRLMELVQYQLKRIR 412
            .......||::....::::..    ::||
 Worm   392 AMLYHAQEGYKANARKIVDTT----RKIR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gad1NP_001261396.1 Pyridoxal_deC 64..434 CDD:395219 82/380 (22%)
spl-2NP_505372.1 DOPA_deC_like 130..493 CDD:99743 74/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.