DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gad1 and sgpl1

DIOPT Version :9

Sequence 1:NP_001261396.1 Gene:Gad1 / 38484 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_005156777.1 Gene:sgpl1 / 100037312 ZFINID:ZDB-GENE-070410-24 Length:574 Species:Danio rerio


Alignment Length:400 Identity:77/400 - (19%)
Similarity:133/400 - (33%) Gaps:121/400 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NQLSNGLDLISMAGEWLTATANTNMFTYEIAPVFILMENVVLTKMREI-----IGWSGG------ 159
            |||:..||.:||:    ..|....|...::.|...|....:|.|:||.     :.|:.|      
Zfish    87 NQLNKALDDMSMS----LCTLKEGMSYTKLLPAQGLTHKQLLDKIREYETLSEVNWAKGKVSGAV 147

  Fly   160 --------DSILAPGGSISNLYAFLAARH-KMFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAA 215
                    |.::...|.    :|:....| .:||..::..:..:..|..:|....     .||..
Zfish   148 YWGDEKLTDLLVKVYGE----FAWTNPLHPDIFPGVRKMEAEVVRMTCALFNGGP-----DSCGT 203

  Fly   216 VCGLGTDH----C----------------IVVPSDEHG-----------KMITSELERLILERKA 249
            |...||:.    |                |:.|...|.           |:|...|:    .:..
Zfish   204 VTSGGTESILMACKAYRDMAHERGIKHPEIIAPISVHAAFDKAAHYFGMKLIHVPLD----NKTM 264

  Fly   250 KGDIPFFVNA-TAGTTVL---------GAFDDINTIADICQKYNCWMHIDAAWGGGLLMSRKHR- 303
            |.|:.....| |..|.:|         |..|.:..:|.:..|||...|:||..||.|::..:.. 
Zfish   265 KVDVKAMRRAITKNTAMLVCSAPQFPHGIMDPVEEVAKLAVKYNIPFHVDACLGGFLIVFMEKAG 329

  Fly   304 ---HPRFTGVERADSVTWNPHKLMGALLQCSTIHFKEDGLLISCNQMSAEYLFMTDKQYDISYD- 364
               .|....|:...|::.:.||...|.        |...:::..|:....|      ||.::.| 
Zfish   330 FKLAPFDFRVKGVTSISADTHKYGYAP--------KGSSVVLYSNRKFRHY------QYFVAPDW 380

  Fly   365 --------------TGDKVIQCGRHNDIFKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIREQS 415
                          .|..:..|         |......|.:|:.:...:::|..: ::|....:.
Zfish   381 QGGIYASPSMAGSRPGGIIAAC---------WATMMHMGEKGYVEATRKVVETTR-KIKTGIRKI 435

  Fly   416 DRFHLILEPE 425
            |...:..:||
Zfish   436 DGVFVFGDPE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gad1NP_001261396.1 Pyridoxal_deC 64..434 CDD:395219 76/399 (19%)
sgpl1XP_005156777.1 DOPA_deC_like 143..504 CDD:99743 59/339 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.