DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpy-30L2 and SDC1

DIOPT Version :10

Sequence 1:NP_647854.1 Gene:Dpy-30L2 / 38480 FlyBaseID:FBgn0035491 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_010757.3 Gene:SDC1 / 852080 SGDID:S000002877 Length:175 Species:Saccharomyces cerevisiae


Alignment Length:50 Identity:18/50 - (36%)
Similarity:28/50 - (56%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RQYLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKNRCDEVKTEEN 98
            |:||:..|.|.||.|::.:|..:|.||:..|..||::..|.....:.|.|
Yeast   123 RKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQSNILKSGEKESN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpy-30L2NP_647854.1 DD_DPY30_SDC1 48..88 CDD:438534 15/38 (39%)
SDC1NP_010757.3 DD_DPY30_SDC1 122..162 CDD:438534 15/38 (39%)

Return to query results.
Submit another query.