DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpy-30L2 and dpy30

DIOPT Version :10

Sequence 1:NP_647854.1 Gene:Dpy-30L2 / 38480 FlyBaseID:FBgn0035491 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001011017.1 Gene:dpy30 / 496426 XenbaseID:XB-GENE-970590 Length:99 Species:Xenopus tropicalis


Alignment Length:77 Identity:34/77 - (44%)
Similarity:46/77 - (59%) Gaps:9/77 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VAKNDSNSQQSVDGIDAFAACQKPRPDTSSMPVRQYLDQTVAPILLHGLQALARDRPSDPISYLA 80
            :.:|:..|.:.:         .|.:.|...:|.|.||||||.||||.||..||::||.:||.|||
 Frog    30 IVENEKTSTEKI---------SKQKVDLQGLPTRAYLDQTVVPILLQGLSVLAKERPPNPIEYLA 85

  Fly    81 TYLLKNKNRCDE 92
            .||||||.:.:|
 Frog    86 AYLLKNKTQFEE 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpy-30L2NP_647854.1 DD_DPY30_SDC1 48..88 CDD:438534 27/39 (69%)
dpy30NP_001011017.1 DD_DPY30_SDC1 53..92 CDD:438534 26/38 (68%)

Return to query results.
Submit another query.