DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpy-30L2 and LOC4578207

DIOPT Version :10

Sequence 1:NP_647854.1 Gene:Dpy-30L2 / 38480 FlyBaseID:FBgn0035491 Length:98 Species:Drosophila melanogaster
Sequence 2:XP_001237951.3 Gene:LOC4578207 / 4578207 VectorBaseID:AGAMI1_001741 Length:80 Species:Anopheles gambiae


Alignment Length:65 Identity:36/65 - (55%)
Similarity:47/65 - (72%) Gaps:4/65 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QKPRPDT-SSMPVRQYLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKNRCDE---VKTEE 97
            :||..:. .|:|.||||||||.||||.||:.||::||.||:.|||.:||:||||.:|   ..||:
Mosquito    14 RKPAGNNLQSLPTRQYLDQTVNPILLQGLKVLAKERPQDPVQYLANFLLQNKNRVEESNGASTED 78

  Fly    98  97
            Mosquito    79  78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpy-30L2NP_647854.1 DD_DPY30_SDC1 48..88 CDD:438534 26/39 (67%)
LOC4578207XP_001237951.3 None

Return to query results.
Submit another query.