DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpy-30L2 and dpy-30

DIOPT Version :10

Sequence 1:NP_647854.1 Gene:Dpy-30L2 / 38480 FlyBaseID:FBgn0035491 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_506058.1 Gene:dpy-30 / 179671 WormBaseID:WBGene00001088 Length:123 Species:Caenorhabditis elegans


Alignment Length:88 Identity:41/88 - (46%)
Similarity:52/88 - (59%) Gaps:9/88 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SPGEGEVNGGGDVAKN--DSNSQQSVDGIDAFAACQKPRPDTSSMPVRQYLDQTVAPILLHGLQA 66
            :|.|.|.|....|..|  .:|..|......|      || :||::|.|||||.||.||||.||.|
 Worm    31 APAEAESNENTTVPSNVLSANGGQQTGNQSA------PR-NTSTVPTRQYLDSTVVPILLQGLGA 88

  Fly    67 LARDRPSDPISYLATYLLKNKNR 89
            ||:|||.:||.:||.:||:.|:|
 Worm    89 LAKDRPENPIEFLANFLLREKDR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpy-30L2NP_647854.1 DD_DPY30_SDC1 48..88 CDD:438534 25/39 (64%)
dpy-30NP_506058.1 DD_DPY30_SDC1 70..110 CDD:438534 25/39 (64%)

Return to query results.
Submit another query.