DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpy-30L2 and arcp-1

DIOPT Version :10

Sequence 1:NP_647854.1 Gene:Dpy-30L2 / 38480 FlyBaseID:FBgn0035491 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001254879.1 Gene:arcp-1 / 175486 WormBaseID:WBGene00009375 Length:1235 Species:Caenorhabditis elegans


Alignment Length:84 Identity:24/84 - (28%)
Similarity:40/84 - (47%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVSPGEGEVNGGGDVAKNDSNSQQSVDGIDAFAACQKPRPDTSSMPVRQYLDQTVAPILLHGLQA 66
            |.:|..|......|.|:...:..:|::. ..|....:.:.|..:.....||.:||||:|...|..
 Worm  1141 PATPDSGSEGSFIDSARMLDDEDESIER-HRFEKAFRGKIDLPTSENGVYLARTVAPVLTKALAE 1204

  Fly    67 LARDRPSDPISYLATYLLK 85
            :...||:|||.::|.:|.|
 Worm  1205 VLLRRPADPIGFIAEWLSK 1223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpy-30L2NP_647854.1 DD_DPY30_SDC1 48..88 CDD:438534 16/38 (42%)
arcp-1NP_001254879.1 ANK repeat 73..104 CDD:293786
ANKYR <76..169 CDD:440430
PHA03095 <100..>291 CDD:222980
ANK repeat 106..141 CDD:293786
ANK repeat 225..251 CDD:293786
ANK repeat 253..285 CDD:293786
Ank_2 460..>503 CDD:463710
ANK repeat 460..487 CDD:293786
ANK repeat 489..519 CDD:293786
ANKYR <616..>721 CDD:440430
ANK repeat 617..644 CDD:293786
ANK repeat 646..678 CDD:293786
ANK repeat 680..712 CDD:293786
ANKYR <812..948 CDD:440430
ANK repeat 812..838 CDD:293786
ANK repeat 840..872 CDD:293786
ANK repeat 874..906 CDD:293786
Ank_2 1003..1097 CDD:463710
ANK repeat 1003..1029 CDD:293786
ANK repeat 1031..1063 CDD:293786
ANK repeat 1065..1097 CDD:293786
DD_DYDC-like 1189..1225 CDD:438535 16/35 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.