DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr97Ea

DIOPT Version :9

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:355 Identity:84/355 - (23%)
Similarity:124/355 - (34%) Gaps:114/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQTPSAN------QYHIQTDEGPERYFRFQTDSGQFRKEKRLQDGTVIGTEAWIDAAGYLRQKDY 76
            ::.|.|:      |.:...::|...| .::...|.|:.|.:|..|.|.|...::|..|.:|..:|
  Fly    49 AEAPRADPVAILKQINKHNEDGSYTY-GYEGADGSFKIETKLATGEVKGKYGYVDETGKVRVVEY 112

  Fly    77 IADKQGYRILKSKTIYVGLGRAVEDAIK-----STKAAPAQSGVLVHGGSSGSSANSLGSYHRPS 136
            .|:|.|:: ...:.|.|.....|::.:|     :.:.||                      .||.
  Fly   113 GANKYGFQ-PSGEGITVAPPTLVDETLKEEPDYADEPAP----------------------QRPQ 154

  Fly   137 YGY-ISSTTSTTTPAPYPPP----ALLDVEDSGAGKLNYLP-PEQAAKIEPQSQLGFDHYPD--- 192
            ..| :........|.|.|.|    ...:||:....::.|.| |:...:..||.|    |.|.   
  Fly   155 KPYRVQRPQPRPQPRPQPQPQPQYVQYEVEEESPRRVQYAPAPQPQPQPLPQPQ----HLPQQHH 215

  Fly   193 -----------ELP---RARDQLLSPL--PATPLSPLVDIHSNGDPVQDLELNAINVYDAEADRA 241
                       ::|   |..|.|.|||  ||.|           :|            |....::
  Fly   216 QPSVGPAPPRLQVPGAQRTTDVLYSPLQRPARP-----------EP------------DYSQTQS 257

  Fly   242 FGHGQFGSVISSTTARPPSLDMLPPLSAHRRRLRPRPTPAP-VAIVSSTPAPISGA----DLYGY 301
            ||.|.....||    ||  :..|||.|           ||| .|......||.||.    :..|:
  Fly   258 FGDGPSNVRIS----RP--VYALPPAS-----------PAPSSARAQGFLAPASGGRPLLEPVGF 305

  Fly   302 STPQ-PFAAPAYQ---FAP-PATSSTTGYG 326
            ...| |.|.|..|   |.| |...:.:|.|
  Fly   306 GQSQGPSARPVQQQPSFQPQPRPQARSGGG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.