DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr78Cb

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster


Alignment Length:106 Identity:22/106 - (20%)
Similarity:43/106 - (40%) Gaps:22/106 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSWLLALVALAAV----------------VTGSQTPSA--NQYHIQ--TDEGPERYFRFQTDSG 45
            |:::|:.:|.||.:                :.|:....|  ..:.:.  .|||..:| .|:|.:|
  Fly     1 MRNFLIGMVLLALIWVEVDARLVRVRRIRRLVGASERDARITDFRVSPTDDEGVFKY-AFKTSNG 64

  Fly    46 QFRKEKRLQDGTVIGTEAWIDAAGYLRQKDYIADKQGYRIL 86
             ...:........||..::....|...:..||||:.|:.::
  Fly    65 -IDVQAAGSPLETIGIYSYTSPEGVPIETRYIADELGFHVV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 11/47 (23%)

Return to query results.
Submit another query.