DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr78Ca

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:84 Identity:24/84 - (28%)
Similarity:37/84 - (44%) Gaps:6/84 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LALVALAAV-VTGSQTPSANQ--YHIQTDEGPERY--FRFQTDSGQFRKEKRLQDGTVIGTEAWI 65
            |.||.:..: .|....||.::  |:..|...|..:  |.|||.:|...|....::|.| |...::
  Fly    11 LVLVLVQLIHCTRFTAPSLDRTIYYRNTPPDPFGHYSFEFQTTNGITTKGAGNENGAV-GVVQFV 74

  Fly    66 DAAGYLRQKDYIADKQGYR 84
            ...|......|:||..||:
  Fly    75 SPEGIPVTFSYVADANGYQ 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 13/46 (28%)

Return to query results.
Submit another query.