DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:86 Identity:23/86 - (26%)
Similarity:37/86 - (43%) Gaps:4/86 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSWLLALVALAAVVTGSQTPSA----NQYHIQTDEGPERYFRFQTDSGQFRKEKRLQDGTVIGTE 62
            |.::||:.|||.....:.:..|    .:|.....|.....:::||.:|...:|..:......|:.
  Fly     3 KFFVLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGVGGYYASGSN 67

  Fly    63 AWIDAAGYLRQKDYIADKQGY 83
            |:....|.|.|..|.||..||
  Fly    68 AYYAPDGQLIQLTYTADSNGY 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 12/46 (26%)

Return to query results.
Submit another query.