DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr65Ea

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:120 Identity:30/120 - (25%)
Similarity:42/120 - (35%) Gaps:37/120 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 ALLPPLPSSSYRRRLRPRPVQGNHLDGLAASEYD-----GVGVTRNGFRYVLPKQYHEEETNPSD 402
            ||..||...:..:.|..:...|.:       .||     |:.:...|.      ..||..     
  Fly    14 ALAAPLNDDTITKFLANQDTDGTY-------AYDIEQASGIQIKEEGL------AGHEAH----- 60

  Fly   403 GKRAGSFGYVDPFGIR-RVVYYNAAPGRGFVHRNNNQFVGANGAPYDSPGPAELV 456
                ||:.|:.|.||. :|||  .|...|| |..:|..      |...|.|.|::
  Fly    61 ----GSYSYISPEGIPVQVVY--TADEFGF-HPQSNLL------PTPPPIPEEIL 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 16/70 (23%)

Return to query results.
Submit another query.