DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr65Aw

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:88 Identity:21/88 - (23%)
Similarity:39/88 - (44%) Gaps:9/88 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LALVALAAVVT-GSQTPSANQYHIQTDEGPERYFRFQTDSGQFRKEKRL--QDGT------VIGT 61
            |.||:..|..: .:.|....:|..:..:.....|.|:|..|..|:|:..  ..||      :.|:
  Fly    10 LILVSFCACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGS 74

  Fly    62 EAWIDAAGYLRQKDYIADKQGYR 84
            ..|:...|...:.:|:||:.|::
  Fly    75 VHWVGPDGIHYKLNYLADENGFQ 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 14/54 (26%)

Return to query results.
Submit another query.