DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr49Ad

DIOPT Version :9

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:112 Identity:29/112 - (25%)
Similarity:43/112 - (38%) Gaps:18/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 YRRRLRPRPVQGNHLDGLAASEY-------DGVGVTRNGFRYVLPKQYHEEETNPSDGKRAGSFG 410
            |....:.|.|:.|:.....|..|       :|:.....|....:..|..||:..       |::.
  Fly    61 YIAAAQARIVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVE-------GAYS 118

  Fly   411 YVDPFGIRRVVYYNAAPGRGFVHRNNNQFVGANGAPY-DSPGPAELV 456
            ::.|.|:|..|.| .|...||  |....:.|.|.|.| ..|.||.:|
  Fly   119 FITPEGLRVGVKY-LADANGF--RPVITYDGVNSAFYAGQPAPANVV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.