DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr49Ac

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:144 Identity:31/144 - (21%)
Similarity:40/144 - (27%) Gaps:69/144 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KAAPAQSGVLVHG-----GSSGSSAN------------------SLGSYHRPSYGYIS------- 141
            |..|:..| ..||     |.|||..:                  .||.||...|.|..       
  Fly    42 KYRPSDDG-KYHGNSQNEGRSGSQESIGRYHHMPIPYRHVSDQRELGKYHHIPYPYDGGYGPYAG 105

  Fly   142 -------------------------------STTSTTTPAPYPPPALLDVEDSGAGKLNYLPPEQ 175
                                           :||||||....|...|.:.:|.|..|:.:     
  Fly   106 SNIPYVHDDRPYNHDLYTSTTTKKPTTTTKRTTTSTTTTTTTPRNILFNYDDEGRHKILH----- 165

  Fly   176 AAKIEPQSQLGFDH 189
              |.|.:.|..:||
  Fly   166 --KEEVRKQDKYDH 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:459790 2/3 (67%)

Return to query results.
Submit another query.