DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:198 Identity:43/198 - (21%)
Similarity:57/198 - (28%) Gaps:89/198 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 GHGQFGSVISSTTARPPSLDMLPPLSAHRRRLRPRPTPAPVAIVSSTPAPISGADLYGYSTPQPF 307
            |.|....|:..|:|||                :||||.|                          
  Fly   112 GGGGAAVVVPRTSARP----------------QPRPTTA-------------------------- 134

  Fly   308 AAPAYQFAPPATSSTTGYGYYPPPQSPVDVNSLEAALLPPLPSSSYRRRLRPRPVQGN------H 366
                   ||||.:..|                   |.||         :.|.....||      .
  Fly   135 -------APPAIADPT-------------------ANLP---------KGRGTGEGGNGWAIIRQ 164

  Fly   367 LDGLAASEYDGVGVTRNGFRYVLPKQYHE-EETNPSDGKRA-GSFGYVDPFGIRRVVYYNAAPGR 429
            .|.:....|..:..|.||   :|.::... |:....:|.|: |.:.|..|.||...|.| .|...
  Fly   165 EDDVEVDGYHYLWETENG---ILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDY-VADDN 225

  Fly   430 GFV 432
            |||
  Fly   226 GFV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 16/57 (28%)

Return to query results.
Submit another query.