DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr47Ef

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:204 Identity:37/204 - (18%)
Similarity:76/204 - (37%) Gaps:56/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 EHEYKSDLDIVSNA-----------SCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDG 194
            ::|||::.::|..|           ..|...::.:.|:...|.|       .....:..:||.:.
  Fly    10 QYEYKANSNLVLQADVRLIERPRRDEATGEVISLVGKLDGTRMG-------DRAQRSKPEKTEER 67

  Fly   195 PSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVPT-------------VDVSV 246
            .:.:..|......||.:..:|..::.:        .::.|:.:|..|             :..::
  Fly    68 KAKRQKRDEAQYDFNSMKGATLLSEGI--------DEMVGIVYRPKTQETRQTYEVLLSFIQEAI 124

  Fly   247 VDLTVRLEKAATYDEIKKAIK------EESEGKMKGILGYTEDDVVS---------TDFVGDNRS 296
            .|....:.:.|. |||...:|      .|.:.::.|:||...|:..:         |||..|..:
  Fly   125 GDQPRDILRGAA-DEILAVLKNDRMKEREKKREIDGLLGSVADERFALLVNLGKKITDFGSDAAT 188

  Fly   297 SIFDA-KAG 304
            :|..| :||
  Fly   189 AIGGAGQAG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 13/49 (27%)

Return to query results.
Submit another query.