DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:100 Identity:23/100 - (23%)
Similarity:35/100 - (35%) Gaps:25/100 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVALAAVVTGSQ---------------TPSANQYHIQTDEGPERYFRFQTDSGQFRKEKRL---- 53
            :.||..::||.|               .|.......|...| ...|.|::..|.:|:|..:    
  Fly     1 MFALLLILTGCQLLWSCPAECTSINVPVPILKSVTEQLSSG-SYLFSFESADGTYREELGIVSSD 64

  Fly    54 -----QDGTVIGTEAWIDAAGYLRQKDYIADKQGY 83
                 .|..|.|...:|:..|...:..|.|||.|:
  Fly    65 SKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGF 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.