DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr47Ec

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster


Alignment Length:79 Identity:22/79 - (27%)
Similarity:31/79 - (39%) Gaps:22/79 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 SEYDGV-GVTRNGFRYVLPKQYHEEETNPSDGKRAGSFGYVDPFGIRRVVYYNAAPGRGFVHRNN 436
            |.|.|. |::||...:::.|...||.....     ||:.|::..|....|:|.|           
  Fly    45 SAYVGADGISRNEEAFLVDKGTDEEALEVK-----GSYKYINEDGQEVEVFYTA----------- 93

  Fly   437 NQFVGANG-APYDS 449
                |.|| .||.|
  Fly    94 ----GKNGFVPYGS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 18/72 (25%)

Return to query results.
Submit another query.