DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Lcp4

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster


Alignment Length:82 Identity:19/82 - (23%)
Similarity:33/82 - (40%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLALVALAAVVTGSQTPSANQY--HIQTDEGPERYFRFQTDSGQFRKEKRLQDGTVIGTEAWIDA 67
            :|.:.||.|:|..::.|...:.  .:|.|....   :...|:|..........|.:.|...|:..
  Fly     4 ILLVCALVALVAANENPEVKELVNDVQADGFVS---KLVLDNGSAASATGDVHGNIDGVFEWVSP 65

  Fly    68 AGYLRQKDYIADKQGYR 84
            .|...:..|.||:.||:
  Fly    66 EGEHVRVSYKADENGYQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 9/40 (23%)

Return to query results.
Submit another query.