DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Lcp3

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_476621.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster


Alignment Length:81 Identity:19/81 - (23%)
Similarity:33/81 - (40%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLALVALAAVVTGSQTPSANQYHIQTDEGPERYF-RFQTDSGQFRKEKRLQDGTVIGTEAWIDAA 68
            :|.:.:|||:|..:......:  :..|..|:.:. :...|.|..........|.:.|...||...
  Fly     4 ILLVCSLAALVAANANVEVKE--LVNDVQPDGFVSKLVLDDGSASSATGDIHGNIDGVFEWISPE 66

  Fly    69 GYLRQKDYIADKQGYR 84
            |...:..|.||:.||:
  Fly    67 GVHVRVSYKADENGYQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Lcp3NP_476621.1 Chitin_bind_4 <46..81 CDD:459790 8/34 (24%)

Return to query results.
Submit another query.