DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Pcp

DIOPT Version :10

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:117 Identity:25/117 - (21%)
Similarity:47/117 - (40%) Gaps:25/117 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 RGGRAASFNIIPS--------STGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAA 257
            |.|..|.:::..|        .:|....:|::|.|::            :|| ||.....:::.|
  Fly   190 RAGARALWSLSESRHNKELMCKSGIVPLMGRLLKSVH------------IDV-VVPTMGTIQQCA 241

  Fly   258 TYDEIKKAIKEESEGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSD 309
            :....:.||  .:||.:..|:.:...|  :.|......|:||...:....||
  Fly   242 SQANYQLAI--TTEGMIFDIVSHLTSD--NLDLKRQCSSAIFKCASDKTASD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.